One problem in today?s indoor air quality lies within insufficient ventilation. Dynamic ventilation can be obtained by implementing a Demand-Controlled ventilation (DCV) system. DCV systems adjust the ventilation in a building by calculating the impact made by its? occupants.

The purpose with this study was to elucidate the pros and the cons with a sale support system. This has been narrowed down into two questions: ?What are the pros and cons for a company that have a sale support system? and what are the pros and cons for a company that does not yet have a system?? Configurator that is a sale support system has been studied. It is a system that presents products by accepting different functions, qualities or parts that are possible to match. It can be used in business-to-business or business-to-consumer situations, through different sale channels, namely direct sale, indirect sale and online sale.

Classification systems express an idea of the world as it was when the systems was made. If the classification system is not revised there is a possibility that the system will become antique and hard to apply to different subjects. The purpose of this study is to see if the SAB-system is a classification system which shows a reflection of the subject Religion that is equivalent with that of Swedish universities. The ideas which are behind the classification of the subject religion in the SAB-system have been analysed, as well as the structuring of the scientific discipline Religion at the universities. The result will show if the SAB-system can classify the subject religion in a satisfying way at university libraries.

Ialladesignprocessermåstemantahänsyntillettmediumsegenskaper.Dettaäringetnyttinomdesign.Ändåförekommerdetoftainommänniska--?datorinteraction(HCI)ochinteraktivsystemdesignattteknikensegenskaperbarasesöversomhastigast.Teknikenäroftaabstraherad,utanatttillräckliguppmärksamhetgestillhurderasdistinktaegenskaperöppnaruppfördesignmöjligheter.IdenhärrapportenbeskrivsetttillvägagångssättsomkallasInspirationalBitsförattblimerbekantmeddesignmaterialetinomHCI,detdigitalamaterialet.Detärocksåettsättförattblibättrepåattförmedlakunskapentillallagruppmedlemmariettinterdisciplinärtdesignteam.InspirationalBitsskapas?snabbtochsmutsigt?menärfulltfungerandesystemibådehard--?ochmjukvara,medmåletattblottaenellerfleraavdedynamiskaegenskapernahosdigitalamaterial..

När ett nytt databassystem ska tas fram och införas i en organisation ska funktioner och krav på systemet identifieras och analyseras i en designprocess. Ett krav på ett databassystem kan vara att systemet ska uppvisa en viss prestanda. Designprocessen leder så småningom fram till fysisk design av databasen och dess applikationer. Det kan finnas flera olika lösningar för fysisk design av databasen och dess applikationer som tillgodoser kraven och funktionerna som ska finnas i systemet. Dessa olika lösningsalternativ ger olika prestanda.

In today?s technological society, there are increasingly less physical demands on the locomotor system. However, despite that notion strength and function in the hand?s complex biomechanical system are in fact both needed to cope with daily life. The grip function is a main function in the hand and is used in many examples of scientific research, for instance when assessing physical health and predicting the probabilities of premature mortality.

The outset of this thesis is to raise questions on how we design for the mobile context and the capabilities of smartphones. Not only the presentation but also the use of input and interaction between a service and a user.This work evolves around sign up forms and answers the question: How does the sign up process affect the holistic perspective of a digital service regarding usability and user experience? This thesis consists of a case studies, and design experiments conducted on Twitter, Instagram and Randos sign up processes to explore if and how the usability, and the user experience could be affected and im- proved.This concluded some important aspects to be considered when designing sign up forms for a digital service.The usability, and the user experience is not only affected by user interaction, and the choice of input method but it?s also affected by which data the service is requesting, and more important; if that data is motivated to request by the service..

The aim of this thesis was to investigate if the robotized welding method FSW (Friction Stir Welding) could be applied for joining a rotating structure in an aero engine at Volvo Aero Corporation. FSW is expected to introduce less defects than today?s welding methods and could therefore be suitable for critical aero components. The material is the nickel based alloy Inconel 718, however a material experimentation is outside the scope of this report.The main goal of this study is to verify if the ESAB ROSIO robot based FSW-system has a suitable work space to be able to weld the rotating structure, and if the welding tool has accessibility to the joints. The FSW-process needs a rigid fixture, and a number of fix-ture concepts are presented based on a proposed weld sequence.

Uppsats för avläggande av filosofie kandidatexamen i Kulturvård, Trädgårdens hantverk och design 21 hp.

If P&C Insurance Company faces a challenge when their treasury system needs a new interface to a software as a service application. They need a suggestion for configuration for how the system and the application can work together. The work presented in this report is a suggestion for how you can make business configuration of an IT-based Treasury System in general. The exact configuration for the case received from If is presented as a separate report, found in Appendix A and is called the If-report. The If-report presents the suggested technical set-up of the configuration.

This thesis presents the implementation of a knowledge base system for rough sets [Paw92]within the logic programming framework. The combination of rough set theory with logic programming is a novel approach. The presented implementation serves as a prototype system for the ideas presented in [VDM03a, VDM03b]. The system is available at "http://www.ida.liu.se/rkbs". The presented language for describing knowledge in the rough knowledge base caters for implicit definition of rough sets by combining different regions (e.g.

I chose to do this work because I believe that today?s industrial designprofessionals lack in their task of creating aesthetic experiences and aestheticdiversity.With my work, I want to question why the majority of today?s technical, massproducedeveryday products have such a similar design expression, andwhy alternatives are so few. Most of all, I take a critical attitude to today?sstereotypical industrial design aesthetics that I would describe as technical,masculine, and unnecessarily complex.I have designed a number of products that show alternative aesthetics in thissegment and as such I have chosen the vacuum cleaner. The idea is that mydesign will serve as an eye opener and demonstrate that there are alternativesto today?s homogeneous market.The result is three vacuum cleaners claiming three alternatives to currentofferings.

Det finns flera studier som visar att text och bild i samverkan är bra för inlärningen och förståelsen. Men att bara lägga till bilder i ett textmaterial eller tvärtom, garanterar ingen förbättring. Hur kan text och bild samverka från ett kognitionsteoretiskt perspektiv i en produktinformation för att öka förståelsen om funktioner i ett komplext system? Det är frågan jag ställer mig i denna studie och avgränsar mig till att analysera en broschyr om internsystemet PERFEKT. Broschyren är framställd av Tjeders som marknadsför och tillverkar komponenter inom bland annat vård och omsorg.

Vad många inte tänker på då de har ett relativt avancerat olinjärt system som de linjäriserat till ett tidskontinuerligt styckvis affint system är att det inte är helt självklart och enkelt att hantera detta system. Eftersom vi i de flesta fall vill kunna hantera ett angivet system med datorkraft, och därmed måste sampla systemet, behöver vi kunna beskriva ett samplat tidskontinuerligt styckvis affint system med ett tidsdiskret system. Vid första anblicken av detta problem kan det verka ganska enkelt. Vad många gör är helt enkelt att skapa en tidsdiskret beskrivning för varje mod i det styckvis affina systemet var för sig och behålla de gamla modgränserna. Detta visar sig dock kunna ge ett felaktigt uppförande hos systemet.

This study is essentially based on my own questions concerning contemporary playgrounds. Why are they so unimaginative? What do the children say about them? Is it possible to create playgrounds less constructed, and with more natural elements? This report starts with references to literature studies, personal references and my personal view, and ends with a suggestion for a physical solution for an actual day care centre. The aim is to learn more about how the natural environment affects children, the importance of playing, and try to use this knowledge in a design of a day care centre. My main theme can be summarized in the following question: Why is natural elements in playgrounds considered to be healthy for children? I wanted to create a playground with natural characteristics which I myself would have appreciated as a child.