The art of riding is a fugitive art, which signifies that the means available for documentation of performances are insufficient, and that the equipment used by the old masters are important clues for the understanding of their art. The most specialized tool used for riding is the bit, in particular the curb. As museum catalogues become accessible to the public through the internet, riders will look for information about BITS. It is then important that the information provided in the catalogues is valid not just for the curator, archaeologist or art historian, but also for the rider.In this paper, I add context to the BITS by explaining two opposing philosophies of bitting, and how they affect the design of the BITS. This is followed by a brief history of the art of riding and how the BITS have evolved since the 16?th century.

Ialladesignprocessermåstemantahänsyntillettmediumsegenskaper.Dettaäringetnyttinomdesign.Ändåförekommerdetoftainommänniska--?datorinteraction(HCI)ochinteraktivsystemdesignattteknikensegenskaperbarasesöversomhastigast.Teknikenäroftaabstraherad,utanatttillräckliguppmärksamhetgestillhurderasdistinktaegenskaperöppnaruppfördesignmöjligheter.IdenhärrapportenbeskrivsetttillvägagångssättsomkallasInspirationalBITSförattblimerbekantmeddesignmaterialetinomHCI,detdigitalamaterialet.Detärocksåettsättförattblibättrepåattförmedlakunskapentillallagruppmedlemmariettinterdisciplinärtdesignteam.InspirationalBITSskapas?snabbtochsmutsigt?menärfulltfungerandesystemibådehard--?ochmjukvara,medmåletattblottaenellerfleraavdedynamiskaegenskapernahosdigitalamaterial..

Mobila enheter såsom bärbara datorer, avancerade handdatorer och mobiltelefonerblir allt vanligare i organisationer. Tidigare har informationssäkerhet byggts upp föratt skydda organisationer från attacker utifrån, men nu måste man även skyddaorganisationen inifrån. Detta för att enheter tas ut ur organisationen och utsätts förandra, möjligt farliga miljöer. För att sedan på nytt föras in i organisationensnätverk. Basnivå för informationssäkerhet, BITS är riktlinjer framtagna avKrisberedskapsmyndigheten.

Aren?t you tired of never finding stuff? Take a BITS as example, do you store these lose in your toolbox or carpenter belt? What if you could have it all accessible and assembled in a tool, always at arm?s reach?Today BITS are used together with electric screwdrivers and handheld screwdrivers in a greater spread. For these different types of storage, from pure storage boxes to complex tools with storage built in, exist. The professional craftsmen commonly use some kind of box where the BITS can be stored. Even so they tend to store their BITS loose in a carpenter belt or toolbox, since they want the speed and accessibility of carpenter belt over the storage box?s tidiness.The project was started in the fall of 2010 and a referents group was early put together to ensure that the developed product became as user-friendly and attractive as possible.

The aim with this study was to investigate the effects a change of manufacturing process would have on the mechanical properties of drill BITS made of a WC/Co composite used for stone cutting. The method used today is sintering, where the material is heated in a conventional sintering oven. The other method was microwave sintering, where the material is heated by radiation in the microwave region. Also an investigation of the manufacturing cost were made.The main difference between the two heating methods is that the conventional way is a rather slow process and the microwave method is very fast. The material is also heated homogeniously in the method with mirowaves, aposed to the case with the conventional sintering where the material is heated from the outside in.This makes the material harder and more wear resistent.

With the huge amount of computers connected to the Internet the IP-addresses are starting to run out. The Internet Engineering Task Force, IETF, have decided that it is about time to exchange the old 32 BITS Internet protocol, Ipv4, to a more modern 128 BITS protocol called Ipv6. This thesis explores the possibility to install Ipv6 in different operating systems. By testing various operating systems and by set up criteria compare them to each other we give the reader a picture of how the installation is done. We also show which operating systems to prefer if you want to use IPv6.

With the huge amount of computers connected to the Internet the IP-addresses are starting to run out. The Internet Engineering Task Force, IETF, have decided that it is about time to exchange the old 32 BITS Internet protocol, Ipv4, to a more modern 128 BITS protocol called Ipv6. This thesis explores the possibility to install Ipv6 in different operating systems. By testing various operating systems and by set up criteria compare them to each other we give the reader a picture of how the installation is done. We also show which operating systems to prefer if you want to use IPv6.

Today the Internet is used more and more as a transportation for information. Much of the information is confidential and should not be read by those not privileged. To protect the information from unauthorized access cryptography can be applied. The cryptography algorithms in use today all have their pros and cons. They are therefore suited for different applications.

Today the Internet is used more and more as a transportation for information. Much of the information is confidential and should not be read by those not privileged. To protect the information from unauthorized access cryptography can be applied. The cryptography algorithms in use today all have their pros and cons. They are therefore suited for different applications.

Internet grows, so it?s cracking, soon will all IPv4 addresses be allocated and a solution is urgently needed. The new protocol, IPv6 is the solution to this problem. With a size of 128 BITS against IPv4s 32 BITS gives IPv6 a huge amount of addresses to distribute. The security addition that may be added manually in IPv4 is the standard with the new protocol.

Uppsatsen syftar till att utvärdera informationssäkerheten i Olofströms kommuns IT-verksamhet för att jämföra resultatet med BITS. Vidare syfte med uppsatsen är att se över de övriga Blekingska kommunernas syn på informationssäkerhet samt hur de arbetar med det. Uppsatsen klarlägger även Olofströms kommuns anställdas syn på informationssäkerhet samt ger en sammanfattning hur deras dator-, lösenords- och e-posthantering ser ut. En tillsyn av Olofströms kommuns dokument "Säkerhetsinstruktion IT, för användare" genomförs för att utvärdera huruvida dokumentet uppnår en acceptabel säkerhetsnivå för informationshantering.Sammanfattningsvis visar resultaten att Olofströms kommun genomför ett aktivt arbete med informationssäkerhet. Resultaten visar även att de övriga Blekingska kommunerna anser att informationssäkerhet är viktigt och de jobbar någorlunda likvärdigt med det.

Bill Gates anses en gång i tiden (1981) ha sagt, att "640 KB borde räcka för vem som helst". Idag är 32-bit teknikens gräns på 2-4 GB ansedd som för liten och det är huvudanledningen till att utvecklingen har gått vidare till 64-BITS minnesadressering. Det förflyttar i dagsläget gränsen till 16 TB och mera potential finns kvar. Detta examensarbete har behandlat förändringar i samband med denna nya teknologi och undersökt vad som ändras vid övergång från 32-bit. Några områden som är värda att nämna som viktiga är nya möjligheter med minneskapaciteter men även förändringar som har att göra med mjukvaror.

Bill Gates anses en gång i tiden (1981) ha sagt, att ?640 KB borde räcka för vem som helst?. Idag är 32-bit teknikens gräns på 2-4 GB ansedd som för liten och det är huvudanledningen till att utvecklingen har gått vidare till 64-BITS minnesadressering. Det förflyttar i dagsläget gränsen till 16 TB och mera potential finns kvar. Detta examensarbete har behandlat förändringar i samband med denna nya teknologi och undersökt vad som ändras vid övergång från 32-bit.

Modern semiconductor design methods makes it possible to design increasingly complex system-on-a-chips (SOCs). Testing such SOCs becomes highly expensive due to the rapidly increasing test data volumes with longer test times as a result. Several approaches exist to compress the test stimuli and where hardware is added for decompression. This master?s thesis presents a test data compression method based on a modified facsimile code.

Use of computers and computer networks is nowadays a part of everyday life. You do not use them only at home when you sit at you computer, but you can use them all the time everywhere. This can involve everything from surf to any website when you are at home, to checking your email on your mobile when you are on your way to work. Most people do not think about how it really works when they try to access a web page by typing the address into their browser, but something that most people probably notice is how long it can sometimes take to access a web page.All items which are directly connected to the IP network have a unique IP address that is used to make it possible to communicate. The IP address is either a period separated sequence of digits representing 32 BITS or a colon separated sequence of digits representing 128 BITS, depending on whether the address is an IPv4 or IPv6 address.