Sök:

Sökresultat:

6202 Uppsatser om Peptide design - Sida 66 av 414

Relationen mellan utformningen av digitala bibliotek och användarnas behov. En intervjustudie vid Göteborgs universitets digitala bibliotek.

The aim of this thesis is to define digital library, and to investigate a relation between the construction of a digital library and user needs. The main questions to be answered are: 1 What criteria was used when constructing a digital library, particularly concerning issues like purpose, function, design, supply, services, resources and future development of the digital library? 2 How do the digital library system designers and system builders criteria correspond with those of postgraduate researchers? And what factors affect the use? A digital library is an enterprise that gives access to information stored digitally and directly available on the net. The crucial is that the enterprise has a control over collection of information and responsibility to make it available to a defined group of users. In order to investigate the relation between the construction of the digital library and user needs, I have interviewed five key people involved with the work with the digital library and twenty postgraduate researchers from the Gothenburg University.

Trädgårdsrum Ekedal. Sinnliga upplevelser för människor med demens

Uppsats för avläggande av filosofie kandidatexamen iKulturvård, Trädgårdens hantverk och design, 21 hp, 2012.

Hallmöbel för förskolor

I have together with Frimeko AB developed new hallway furniture for preschools. The background to the project is the fact that all the existing hallway furniture?s on the market today have a similar design and same features. None of the furniture stands out immediately. Companies who work with school furniture in general have been inspired by each other, and therefore is the collections monotonous.

Jag bara lärde mig! : En studie om typografi i läromedel för läsinlärning

We studied the initial process of reading, with a focus on typography, whether it ispossible to increase childrens lust to read in the age six to seven years old, byadjusting the typography and graphic design. We conduct this study through qualitative and quantitative studies, mainlyinterviews with a main focus on children in this particular age were used. In additionto the interviews a questioniare were sent out to a selection of students. The studyalso contained an interview with a pedagogue as well as studies of the current andexisting textbooks and teaching aids that is used on the school we are looking into.During the study we consulted educated pedagogues to get an understanding of thechildren and their learning and to be able to approach them in a suitable way.The theories we have been using were mainly from a typographic point of view.Other areas we explored were theories about reading processes. This study showedthat every child needs a method that is suitable for them and that the materialprovided today is typographically inconsistent. The childrens and teachers needs andwishes in typography did not correspond with the current teaching aids design. From this study the followning points were made about how to design a textbook forchildren in the first grade:? The typeface should be a sans serif.? The point size should be bigger than 12 points.? Text should be aligned to the left.? Sentences should be short without becoming abstract.? To maintain focus on the text the layout should be simple and unbarked.? The format should be designed after the pourpose of the publication, forexample when it is a complement to the textbook, the format should be of suchcharacter that it is easy for the children to bring home.? There should be a typographical consistency through all of the materialsprovided to the children..

Kvarteret Veiberg : från sluten innergård till öppen mötesplats

The object of the thesis is to propose a new design for the neighbourhood of Veiberg that is situated in the small Norwegian town Jessheim. My approach was to first make an analysis of the whole community and the structure of the town, and then gradually focus on the actual neighbourhood to continue the research there. On the basis of my research the block will be redesigned. The research will lead to a well-planned design of the neighbourhood, which will adapt it to its surroundings in a sustainable and constructive way. The project will lead you through the history of the town and the intentions and aims of the municipality. The project also examines the structure of the town and the function of the neighbourhood in the town today as well as investigation of the history, the structure and the qualities in the area.

People make a difference: en unik fotobok om människors påverkan i samhället

Det här projektet är det sista och avslutande momentet på vår utbildning Medie-design vid Luleå Tekniska Universitet och kallas för ett c-arbete. Tack vare moderniseringen av utbildningen som vi går så har vi numera möjligheten att göra ett konstnärligt arbete istället för att skriva en vetenskaplig rapport. Det innebär att vi har lagt mycket tid på att planera och framställa en grafisk produkt och den här rapporten redogör för vår process från planeringsstadiet till den färdiga produkten. Syftet med detta projekt är att vi ska lära oss hur boktryckningsprocessen fungerar och samtidigt öppna läsarnas ögon för hur stor skillnad människor verkligen gör i samhället. Vidare kommer vi som nyexaminerade mediedesigners att använda oss av detta grafiska arbete och visa upp det som en del av vår portfolio vid framtida arbetsintervjuer.

Hopfällbar hjullösning

In many products a compromise between ground clearance and the required space to store the product has to be made. This problem attracted the attention of the authors of this thesis.The objective of this project is to develop a functioning solution to a foldable wheel. The solution should be applicable to several types of product groups. A limitation for this work has been made so that the work only covers solutions for lighter vehicles.The purpose is to drive this project forward, so that a solution can be found. Furthermore the purpose of the report is to clarify how the authors proceeded to design and construct the wheel according to a fixed specification.

Kreativitet : Mål eller medel i gymnasieskolans designämnen

This degree project deals with the concept of creativity and the creative output based on howSwedish upper-secondary design teachers within the Technical Engineering Programexperience this from a student's perspective. The project discusses how the concept creativityis interpreted and how the creative output is regarded by educationalists and professionaldesigners and how this then can be related to literature on the subject and in the steeringdocuments. The purpose of this degree project is to visualize the interviewees' viewpoint oncreativity and the significance of experience, skills, and environment for the creative outputand within the field of design. This in order to, in the pedagogic and didactic situation, enablethe improvement of teaching so that creativity and its output come to show. Moreover, theproject aims to create a ground for discussion of the view of the importance of these skills inthe pedagogic/didactic situation.In order to reach this aim, I have read literature on creativity from several perspectives andcarried out eight qualitative structured interviews: both with three educationalists withoutexperience within the design profession, and with two educationalists who are or have beenactive within the design profession, as well as with three professional designers.

En ny Upplevelse - En studie i formgivande av interaktioner på webben och effektivisering av arbetsflöden

We?re all aware that technology progresses forward with giant leaps on a daily basis. In one-way or another this affects us in our everyday life. It can affect us in the way we?re shopping, communicating, researching, planning future events or how we choose to be entertained. That the web is an increasingly stronger tool for communicating in more or less every type of business is becoming more evident for people.

Xlight-Retro : En lampa för offentliga inomhusmiljöer

The company Sound Precision has developed a new Line Array loudspeaker system (VHA-40). When using this system, their customers need computer aid to get the best possible sound-quality and control of sound levels for the whole audience. The aim of this thesis is to develop a truly useful sound quality simulator for the VHA-40. The system will help the sound engineers to position the loudspeakers for optimal sound by simulating loudspeaker configurations and visualizing the resulting sound quality and quantity. To solve this a human-centered design (HCD) approach is taken to implement a system that is truly useful for the users, meaning that they will use it more and hence deliver better sound for the audience.

Inspirational Bits : Förmedla teknik i en designmiljö

Ialladesignprocessermåstemantahänsyntillettmediumsegenskaper.Dettaäringetnyttinomdesign.Ändåförekommerdetoftainommänniska--?datorinteraction(HCI)ochinteraktivsystemdesignattteknikensegenskaperbarasesöversomhastigast.Teknikenäroftaabstraherad,utanatttillräckliguppmärksamhetgestillhurderasdistinktaegenskaperöppnaruppfördesignmöjligheter.IdenhärrapportenbeskrivsetttillvägagångssättsomkallasInspirationalBitsförattblimerbekantmeddesignmaterialetinomHCI,detdigitalamaterialet.Detärocksåettsättförattblibättrepåattförmedlakunskapentillallagruppmedlemmariettinterdisciplinärtdesignteam.InspirationalBitsskapas?snabbtochsmutsigt?menärfulltfungerandesystemibådehard--?ochmjukvara,medmåletattblottaenellerfleraavdedynamiskaegenskapernahosdigitalamaterial..

Att planera, markera och dokumentera tid

For a long time I have felt that there is a lack of time planning productson the market that attracts me to use them. Therefore I wantedto explore the possibilities of developing something that I reallywanted to use.At first I tried to come up with a more general tool for planningand structuring time, different from the products that are alreadyavailable. But soon I found it more interesting to see myself as theprimary user. This way I felt that I could experiment more and Ididn?t have to take things like production, cost and possible targetgroups into consideration.As I set out with an aim to try and understand my own problemswith planning and structuring time the project became a very personalone.

Industriellt byggande – en nulägesrapport

Today more effective computer programs are in use, regarding design of geotechnicalconstructions. There is a risk that the theoretical background of the computerprograms, its limitations and the signification of the choice of soil parameter isforgotten when the computer programs become more user-friendly.This Master thesis deals with simulation and analysis regarding three computerprograms, FEM-design, with the addition Raft, Plaxis and BE-slab. Comparisons aremade for settlement and maximum moment in a concrete-plate. FEM-design is a threedimensional FEM-program, foremost created for design engineers. Plaxis is a twodimensional FEM-program, intended for geotechnical engineers while BE-Slab is aBoundary elements program in two dimensions that is mainly used by designengineers.

Barns utemiljöer i Hebron : gestaltningsverktyg för barnperspektiv implementerat på Al Ibrahimyye plats

This is a final thesis for the Master?s Programme in Landscape Architecture at the Faculty of Landscape Planning, Horticulture and Agricultural Science. The subject of the thesis is the outdoor environment of children in Hebron.The thesis aim is to investigate children?s basic needs and desires in their outdoor environment, and how these can be met in the design of a site in Hebron. A starting point for thesis is that children?s environments in the city should not be separated from city life in general, so that children and adults can meet in the city outdoor environment.The ongoing political conflict between Israel and Palestine is presented in the thesis by describing its consequences for the city of Hebron and the lives of its residents, with a particular focus on the everyday lives of Hebron children.

When Madison Avenue turns into Main Street: Consumer generated advertising as a marketing tool and its effects on online word of mouth

The purpose of this study is to investigate the effectiveness of consumer generated advertising as a marketing tool to encourage online word of mouth. Subsequently, the researchers aim to examine if there are certain design factors in consumer generated advertising that influence the effectiveness of consumer generated advertising in encouraging online word of mouth. The study conducts a multiple case study of several consumer generated advertising campaigns. It consists of in-depth studies of these cases in combination with quantitative analyses of the encouraged word of mouth. The different cases are examined on several design factors that could possible increase the volume of encouraged word of mouth..

<- Föregående sida 66 Nästa sida ->