Sök:

Sökresultat:

8262 Uppsatser om Inspirational Bits Communicating Technology in a Design - Sida 1 av 551

Inspirational Bits : Förmedla teknik i en designmiljö

Ialladesignprocessermåstemantahänsyntillettmediumsegenskaper.Dettaäringetnyttinomdesign.Ändåförekommerdetoftainommänniska--?datorinteraction(HCI)ochinteraktivsystemdesignattteknikensegenskaperbarasesöversomhastigast.Teknikenäroftaabstraherad,utanatttillräckliguppmärksamhetgestillhurderasdistinktaegenskaperöppnaruppfördesignmöjligheter.IdenhärrapportenbeskrivsetttillvägagångssättsomkallasInspirationalBitsförattblimerbekantmeddesignmaterialetinomHCI,detdigitalamaterialet.Detärocksåettsättförattblibättrepåattförmedlakunskapentillallagruppmedlemmariettinterdisciplinärtdesignteam.InspirationalBitsskapas?snabbtochsmutsigt?menärfulltfungerandesystemibådehard--?ochmjukvara,medmåletattblottaenellerfleraavdedynamiskaegenskapernahosdigitalamaterial..

Den falska nyckeln : Stångbett för skolridning - historia, terminologi, katalogisering

The art of riding is a fugitive art, which signifies that the means available for documentation of performances are insufficient, and that the equipment used by the old masters are important clues for the understanding of their art. The most specialized tool used for riding is the bit, in particular the curb. As museum catalogues become accessible to the public through the internet, riders will look for information about bits. It is then important that the information provided in the catalogues is valid not just for the curator, archaeologist or art historian, but also for the rider.In this paper, I add context to the bits by explaining two opposing philosophies of bitting, and how they affect the design of the bits. This is followed by a brief history of the art of riding and how the bits have evolved since the 16?th century.

Informationssäkerhet och mobila enheter

Mobila enheter såsom bärbara datorer, avancerade handdatorer och mobiltelefonerblir allt vanligare i organisationer. Tidigare har informationssäkerhet byggts upp föratt skydda organisationer från attacker utifrån, men nu måste man även skyddaorganisationen inifrån. Detta för att enheter tas ut ur organisationen och utsätts förandra, möjligt farliga miljöer. För att sedan på nytt föras in i organisationensnätverk. Basnivå för informationssäkerhet, BITS är riktlinjer framtagna avKrisberedskapsmyndigheten.

qbits : Kombinerar användning och förvaring av bits

Aren?t you tired of never finding stuff? Take a bits as example, do you store these lose in your toolbox or carpenter belt? What if you could have it all accessible and assembled in a tool, always at arm?s reach?Today bits are used together with electric screwdrivers and handheld screwdrivers in a greater spread. For these different types of storage, from pure storage boxes to complex tools with storage built in, exist. The professional craftsmen commonly use some kind of box where the bits can be stored. Even so they tend to store their bits loose in a carpenter belt or toolbox, since they want the speed and accessibility of carpenter belt over the storage box?s tidiness.The project was started in the fall of 2010 and a referents group was early put together to ensure that the developed product became as user-friendly and attractive as possible.

En ny Upplevelse - En studie i formgivande av interaktioner på webben och effektivisering av arbetsflöden

We?re all aware that technology progresses forward with giant leaps on a daily basis. In one-way or another this affects us in our everyday life. It can affect us in the way we?re shopping, communicating, researching, planning future events or how we choose to be entertained. That the web is an increasingly stronger tool for communicating in more or less every type of business is becoming more evident for people.

E-BUSINESS, WHAT IS IT GOOD FOR: AN EXPLANATORY STUDY OF FIVE COMPANIES? E-BUSINESS SOLUTIONS

The notion of firms interacting with technology is not new; these types of systems were already in place in the mid eighties. E-business users worked with connections between their inbound logistics and procurement systems, and suppliers? order-entry systems. When these connections were described for the first time the vertical links between two, or more, value chains in a value system received more attention in firm strategy. The design of the linkages in the value system was said to be a product of the need for coordination and relative bargaining power.

En studie av metodbyte vid sintring av hårdmetaller till mikrovågsintring samt dess ekonomiska fördelar : Självständigt arbete i teknisk fysik med materialvetenskap & Självständigt arbete i kemiteknik

The aim with this study was to investigate the effects a change of manufacturing process would have on the mechanical properties of drill bits made of a WC/Co composite used for stone cutting. The method used today is sintering, where the material is heated in a conventional sintering oven. The other method was microwave sintering, where the material is heated by radiation in the microwave region. Also an investigation of the manufacturing cost were made.The main difference between the two heating methods is that the conventional way is a rather slow process and the microwave method is very fast. The material is also heated homogeniously in the method with mirowaves, aposed to the case with the conventional sintering where the material is heated from the outside in.This makes the material harder and more wear resistent.

SPELA MERA : ?vidareutveckling av design och funktion på Interaktiva VideoTerminaler

This Master of Science thesis is conducted at the faculty Integrated Product Development at theRoyal Institute of Technology and in cooperation with EssNet Interactive AB, both situated inStockholm. In the report the final results and the road to get there is described as well as thedesign process and how the process is used to obtain the goal of this thesis.The author of this thesis has developed the design and the function of an interactive videoterminal (IVT) and by using semantics created an encouraging gaming design. The projectspurpose was to change the anonymous withheld shape and produce an experience of gamingmachine that has been absent. The work was aimed to answer the question: How does oneproceed to develop the IVT and by using semantics creating an understanding of gamingmachine?In general the author wants to show that small changes, with the help of design and its signals,can completely change the overall picture of a product.

Hör upp!!

In this Bachelor thesis I explore sound and room as elements in design of user interfaces, both theoretical and practical in a specific application domain, to identify some of the advantages and disadvantage associated with these elements. As application domain I studied email clients and their usage at home amongst students at Blekinge Institute of Technology. In the study I found an activity, which seems to be highly distributed in the physical room where the user is located. The activity was notification of email and could take place in an arbitrary location of the home. I then augmented this activity with ideas from my theoretical assumption about room and sound.

Från statisk till följsam webbdesign : Den nya webbteknikens väg till företagen

The IT industry is constantly evolving and requires everyone working with website development to be updated on the latest methods. The web grows larger every day, and more visits are carried out by mobile devices. It is more important than ever for companies to have updated and functional pages that can be used on different platforms. We want to find out how common it is for IT departments and web agencies to embrace the newest technology and also what it takes to get them to move from one technology to another. Responsive web design is a constantly growing new technique that helps web developers developing for different platforms.

Interacting with EDIT. A Qualitative Study on, and a Re-design of, an Educational Technology System

This thesis aimed to study the interaction between an educational technology system and its users and give suggestions for design improvements. The technology system is called EDIT (Educational Development through Information Technology) and has been developed and applied at Linköping University?s Faculty of Health Science. EDIT supports Problem Based Learning and enables scenarios to be presented through the World Wide Web. The study was divided into two parts.

The Communicating Home - Definition, Evaluation and Business Opportunities for TeliaSonera in a 3-5 years perspective

The communicating home concept has been defined byidentifying the dominating communication technologiesto/from and in the homes, the most important customerbehavior and user needs, the dominating products and thedominating actors of the industry.The evaluation of the communicating home industry has beenperformed with a five forces framework analysis and theoriesregarding value migration and value structures of industries. Ithas been concluded that actors of communication technologies,goods and access services will compete fiercely. The barriersof entry will however be high. When it comes to contentservices the situation is completely different. These actors will,to the largest extent, meet lower competition and low barriersof entry.

Hör upp!!

In this Bachelor thesis I explore sound and room as elements in design of user interfaces, both theoretical and practical in a specific application domain, to identify some of the advantages and disadvantage associated with these elements. As application domain I studied email clients and their usage at home amongst students at Blekinge Institute of Technology. In the study I found an activity, which seems to be highly distributed in the physical room where the user is located. The activity was notification of email and could take place in an arbitrary location of the home. I then augmented this activity with ideas from my theoretical assumption about room and sound. The result was a rule-based agent for notification of email, which primarily uses sound as interaction style..

Ser det inte lite lika ut? : En kvalitativ studie av den icke stylade bildens potential att inspirera individen

Purpose: The purpose of this study is to investigate the effect and potential of a non-styled home reportage, and how they influence and inspire to promote individual creativity.Method: I have used a qualitative analysis to be able to create a deep understanding. This is based on three interviews with women in age 22-27, which have a dedicated interest in interior design. I have also sent questionnaires to two persons who run interior design blogs.Conclusions: My analysis shows that the non-styled home reportage is the start of an inspirational process that is beyond consumption and status objects. It promotes individual creativity and willingness to create, based on personnel taste. The essay highlights the importance that the individual critically examines the aesthetics of interior design as presented in diverse media.

Deterministisk Komprimering/Dekomprimering av Testvektorer med Hjälp av en Inbyggd Processor och Faxkodning

Modern semiconductor design methods makes it possible to design increasingly complex system-on-a-chips (SOCs). Testing such SOCs becomes highly expensive due to the rapidly increasing test data volumes with longer test times as a result. Several approaches exist to compress the test stimuli and where hardware is added for decompression. This master?s thesis presents a test data compression method based on a modified facsimile code.

1 Nästa sida ->